DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9799 and CG9123

DIOPT Version :10

Sequence 1:NP_650284.2 Gene:CG9799 / 41647 FlyBaseID:FBgn0038146 Length:922 Species:Drosophila melanogaster
Sequence 2:NP_573018.1 Gene:CG9123 / 32462 FlyBaseID:FBgn0030629 Length:434 Species:Drosophila melanogaster


Alignment Length:364 Identity:72/364 - (19%)
Similarity:134/364 - (36%) Gaps:118/364 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 KIFVVDMHTRVIVRKFVGHTAKLNDLTFSPDSRWLITAAMD---------STIKVWD-------- 611
            :|||.||.||...:..:.|..::|.|.|:||...|::.:.|         |..|.:|        
  Fly    68 RIFVYDMRTRKQSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWQKAHAGQ 132

  Fly   612 -------IPSS---------YMVDHFRVEAPCVS-----------------LSMSPNGDFLATAH 643
                   .|||         .:::.:.:...||:                 ||.|..||....: 
  Fly   133 AVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTNLKNKATLDFQTGCLSWSKQGDHFTLS- 196

  Fly   644 VGLLGIYLWANKTLFNQISLRSID-PLEPAPYVGLPTNVCDAMELEDG-MKELEIDEEDESKLGE 706
             |.|.:.:|.   :.|...:|.|: |.:|.....|..|.| ...|::| :..:.:.:||::....
  Fly   197 -GPLVLEIWG---IENAHVMRRIEMPSKPICITWLDGNEC-LTGLDNGNIAWISLKDEDDTPPTF 256

  Fly   707 LV--DTKYETPTQLSEELITLSGLAASR-WQ-----------------------NLLDLEL---- 741
            ::  :.:.:....|:|.|.|:|.....: |:                       .||||..    
  Fly   257 ILAHEVRVKAIAYLNEFLATVSIAGQIKVWKIDMETRKLEEIARSFMDCRPTDLGLLDLRQFGNV 321

  Fly   742 --IKQRNKPKAPPKAPKQ--------APFFLPTVS-GLELRFDVENGQKEEDESRIRKASTLNNL 795
              ::||.|.:..|||..:        ||....|:. ..:.:.|.|..::::...:..::|..:|.
  Fly   322 RPVEQRTKVEEKPKAKVESDQSAKPAAPRGFVTIEYEQDKKLDAEKKKEKKKNKKDEESSEESNS 386

  Fly   796 TAFGQLLEETADSLDFASAVAHLTQLGPSMVDFEIKSLH 834
            :       |..::.||:.:            |.::.|.|
  Fly   387 S-------EDKENDDFSDS------------DSDVSSDH 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9799NP_650284.2 WD40 repeat 84..116 CDD:293791
WD40 111..372 CDD:475233
WD40 repeat 162..201 CDD:293791
WD40 198..642 CDD:441893 28/127 (22%)
WD40 repeat 206..242 CDD:293791
WD40 repeat 249..285 CDD:293791
WD40 repeat 291..331 CDD:293791
WD40 repeat 337..364 CDD:293791
WD40 repeat 408..447 CDD:293791
WD40 repeat 458..496 CDD:293791
WD40 repeat 502..540 CDD:293791
WD40 repeat 545..580 CDD:293791 7/15 (47%)
WD40 repeat 587..622 CDD:293791 13/67 (19%)
Utp21 717..918 CDD:461219 29/157 (18%)
CG9123NP_573018.1 WD40 repeat 50..85 CDD:293791 7/16 (44%)
WD40 <59..289 CDD:441893 49/226 (22%)
WD40 repeat 91..129 CDD:293791 10/37 (27%)
WD40 repeat 134..170 CDD:293791 5/35 (14%)
WD40 repeat 178..216 CDD:293791 10/42 (24%)
WD40 repeat 222..257 CDD:293791 7/35 (20%)
WD40 repeat 264..288 CDD:293791 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.