DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and dnaJ

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_414556.1 Gene:dnaJ / 944753 ECOCYCID:EG10240 Length:376 Species:Escherichia coli


Alignment Length:314 Identity:120/314 - (38%)
Similarity:166/314 - (52%) Gaps:22/314 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE---KFKAISQAYEVLSDADKRQ 62
            |.|: .||:||||...|...|::|||::||:|||||:|..:.|   |||.|.:|||||:|:.||.
E. coli     1 MAKQ-DYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRA 64

  Fly    63 VYDEGGEAAIKKGGADSGDFRNPMDFFEKF---FGAGFGGSGGGRRRERRGKDVVHQMSVQLEEL 124
            .||:.|.||.::||...|.|....||.:.|   ||..||| |.||:|..||.|:.:.|.:.|||.
E. coli    65 AYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDIFGG-GRGRQRAARGADLRYNMELTLEEA 128

  Fly   125 YNGATRKLQLQKNVICDKCEGRGGKKGS-IEKCLQCRGNG-VETRVQQIAPGIMQHIEQVCRKCS 187
            ..|.|:::::.....||.|.|.|.|.|: .:.|..|.|:| |:.|....|      ::|.|..|.
E. coli   129 VRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFFA------VQQTCPHCQ 187

  Fly   188 GTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQP-GDIIILLDE 251
            |.|..|  ||.|..|.|...|...|.|.|.|..|:..|.:|...|||:......| ||:.:.:..
E. coli   188 GRGTLI--KDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLAGEGEAGEHGAPAGDLYVQVQV 250

  Fly   252 KEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIV---STQPGEVIR 302
            |:|..|...|.:|..::|:....|..|.:..|.|||.|..:.   .||.|::.|
E. coli   251 KQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVKLKVPGETQTGKLFR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 119/313 (38%)
DnaJ 7..65 CDD:278647 32/60 (53%)
DnaJ_C 112..336 CDD:199909 63/197 (32%)
DnaJ_zf 140..206 CDD:199908 25/67 (37%)
dnaJNP_414556.1 PRK10767 1..372 CDD:236757 120/314 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.