DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and CAJ1

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_010967.3 Gene:CAJ1 / 856772 SGDID:S000000850 Length:391 Species:Saccharomyces cerevisiae


Alignment Length:133 Identity:58/133 - (43%)
Similarity:81/133 - (60%) Gaps:23/133 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE---KFKAISQAYEVLSDADKRQ 62
            |||||.||||||:||.|||.|:|||||:.|::.||||:|::.:   ||:|:.:||:||||...|.
Yeast     1 MVKETEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSDPGLRS 65

  Fly    63 VYDE-GGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYN 126
            .||: |.|.|:.:.|.:..         .::|.|.|||.|        .||.:.:.|: .:|| |
Yeast    66 KYDQFGKEDAVPQQGFEDA---------SEYFTAIFGGDG--------FKDWIGEFSL-FKEL-N 111

  Fly   127 GAT 129
            .||
Yeast   112 EAT 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 57/132 (43%)
DnaJ 7..65 CDD:278647 33/60 (55%)
DnaJ_C 112..336 CDD:199909 7/18 (39%)
DnaJ_zf 140..206 CDD:199908
CAJ1NP_010967.3 DnaJ 2..>98 CDD:223560 49/112 (44%)
DnaJ-X 176..376 CDD:405064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.