DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and APJ1

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_014322.1 Gene:APJ1 / 855647 SGDID:S000005021 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:459 Identity:136/459 - (29%)
Similarity:204/459 - (44%) Gaps:104/459 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE---KFKAISQAYEVLSDADKRQ 62
            |.:.|..||.|.|...|:..|:|||||..|||||||||.:..|   ||:.|.||||:|.|...|.
Yeast     1 MQQNTSLYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKDNRLRA 65

  Fly    63 VYDEGG---EAAIKKGGA-----DSGDFR---------------NPMDFFEKFFGAGFGGSGGGR 104
            :||:.|   |..|::..|     .:|.|.               :|.|.|.:||.:....|..|.
Yeast    66 LYDQYGTTDEVLIQEQQAQAQRQQAGPFSSSSNFDTEAMSFPDLSPGDLFAQFFNSSATPSSNGS 130

  Fly   105 RRE----------------------------------------RRGKDVVHQMSVQLEELYNGAT 129
            :..                                        .||.|:.|.:...|:|||.|.|
Yeast   131 KSSFNFSFNNSSTPSFSFVNGSGVNNLYSSSAKYNSNDEDHHLDRGPDIKHNLKCTLKELYMGKT 195

  Fly   130 RKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQ 194
            .||.|.:..||..|:|.||.|..  .|..|:|.|::|:.:::.| ::|...|.|..|.|.|..::
Yeast   196 AKLGLNRTRICSVCDGHGGLKKC--TCKTCKGQGIQTQTRRMGP-LVQSWSQTCADCGGAGVFVK 257

  Fly   195 EKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGD---------HEPESQPGDIIILLD 250
            .||.|:.|.|...::|||:|:|.::.|....|.||.|||||         || :..|||::|.:.
Yeast   258 NKDICQQCQGLGFIKERKILQVTVQPGSCHNQLIVLTGEGDEVISTKGGGHE-KVIPGDVVITIL 321

  Fly   251 EKEHSTF--AHAGQDLMMKMPLQLVEALCG---------FQRIVKTLDDRDLIVSTQPGEVIRHE 304
            ..:...|  .:....:..|..:..:.:|||         ..:::|.    |:|    |||:::..
Yeast   322 RLKDPNFQVINYSNLICKKCKIDFMTSLCGGVVYIEGHPSGKLIKL----DII----PGEILKPG 378

  Fly   305 MTKCIAEEGMPIFKNPMEK--GTLIIQFEVIFPEVINPSVVPTLKQCLPPAPEVDIPIDAEQTVL 367
            ..|.:.:.|||.|.|.:..  |.|.::|:|.:||.:.|.....::..|..    |..|.||::.:
Yeast   379 CFKTVEDMGMPKFINGVRSGFGHLYVKFDVTYPERLEPENAKKIQNILAN----DKYIKAERSTM 439

  Fly   368 EDFD 371
            |..|
Yeast   440 ETAD 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 135/458 (29%)
DnaJ 7..65 CDD:278647 31/60 (52%)
DnaJ_C 112..336 CDD:199909 76/245 (31%)
DnaJ_zf 140..206 CDD:199908 23/65 (35%)
APJ1NP_014322.1 DnaJ 2..427 CDD:223560 128/436 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343997
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43888
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.