DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and HLJ1

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_013884.1 Gene:HLJ1 / 855196 SGDID:S000004771 Length:224 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:65/195 - (33%)
Similarity:84/195 - (43%) Gaps:72/195 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGG- 68
            :|:||.|...||..|:||||||||:|.|||||  |..||.||.|::|:||||:.:||.:||..| 
Yeast    22 FYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRSIYDRIGR 86

  Fly    69 ---EAAIKKGGADSGDFRN---------------------------PMDFFEKFFGAG------- 96
               :..:...||.|| ||.                           |.|.|:..|.||       
Yeast    87 DPDDRQMPSRGAASG-FRGSAGGSPMGGGFEDMFFNSRFGGQRAGPPEDIFDFLFNAGGSPFGAS 150

  Fly    97 ----------FGGSGGGR------------RRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVI 139
                      |||.||.|            |::.|.:    |...|.||  |....:|   ||::
Yeast   151 PFGPSASTFSFGGPGGFRVYTNNRGGSPFMRQQPRSR----QQQQQAEE--NAVNSQL---KNML 206

  Fly   140  139
            Yeast   207  206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 65/195 (33%)
DnaJ 7..65 CDD:278647 34/59 (58%)
DnaJ_C 112..336 CDD:199909 8/28 (29%)
DnaJ_zf 140..206 CDD:199908 65/195 (33%)
HLJ1NP_013884.1 DnaJ_bact 22..>154 CDD:274090 49/132 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.