Sequence 1: | NP_650283.1 | Gene: | Droj2 / 41646 | FlyBaseID: | FBgn0038145 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_013884.1 | Gene: | HLJ1 / 855196 | SGDID: | S000004771 | Length: | 224 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 195 | Identity: | 65/195 - (33%) |
---|---|---|---|
Similarity: | 84/195 - (43%) | Gaps: | 72/195 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGG- 68
Fly 69 ---EAAIKKGGADSGDFRN---------------------------PMDFFEKFFGAG------- 96
Fly 97 ----------FGGSGGGR------------RRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVI 139
Fly 140 139 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Droj2 | NP_650283.1 | PTZ00037 | 2..398 | CDD:240236 | 65/195 (33%) |
DnaJ | 7..65 | CDD:278647 | 34/59 (58%) | ||
DnaJ_C | 112..336 | CDD:199909 | 8/28 (29%) | ||
DnaJ_zf | 140..206 | CDD:199908 | 65/195 (33%) | ||
HLJ1 | NP_013884.1 | DnaJ_bact | 22..>154 | CDD:274090 | 49/132 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |