DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and DJP1

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_012269.1 Gene:DJP1 / 854820 SGDID:S000001443 Length:432 Species:Saccharomyces cerevisiae


Alignment Length:432 Identity:107/432 - (24%)
Similarity:168/432 - (38%) Gaps:123/432 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNE---GEKFKAISQAYEVLSDADKRQ 62
            ||.:|.|||:|||...|:..|:||||||.:::.|||||||:   .|:|:|||:||:||.|.|.|.
Yeast     1 MVVDTEYYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGDDDLRA 65

  Fly    63 VYDE-GGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYN 126
            .||: |.:.||.:||     |.:..:.|...||.....|                        |.
Yeast    66 KYDKYGRKEAIPQGG-----FEDAAEQFSVIFGGDAFAS------------------------YI 101

  Fly   127 GATRKLQLQKNVICDKCEGRGGK-KGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTG 190
            |   :|.|.||:  .|.|....: :...||      ..|||..:..|.|          |.:||.
Yeast   102 G---ELMLLKNL--QKTEELNAEDEAEKEK------ENVETMEESPADG----------KTNGTT 145

  Fly   191 ETI----------QEKDRCKNCSGRKTVRE--RKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPG 243
            ..:          .:|::.:..||..||.:  :|..:|..|...:..:...|..|.:.|.:.:..
Yeast   146 NAVDAALGNTNEKDDKNKARTTSGNLTVHDGNKKNEQVGAEAKKKKTKLEQFEEEQEVEKQKRVD 210

  Fly   244 DIIILLDEK----EHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHE 304
            .:...|.|:    ..|.:..|.:|...|                |..::.:|:.....|..|.|.
Yeast   211 QLSKTLIERLSILTESVYDDACKDSFKK----------------KFEEEANLLKMESFGLDILHT 259

  Fly   305 MTKCIAEE-----------GM-PIFKNPMEKGTLIIQFEVIFPEVINPSVVPTLKQCLPPAPEVD 357
            :.....|:           || .||.:...||.:.:.               ||:       .|.
Yeast   260 IGDVYYEKAEIFLASQNLFGMGGIFHSMKAKGGVFMD---------------TLR-------TVS 302

  Fly   358 IPIDAEQTVLEDFDPKQRRQQHQRMAYDEDDGGYQDGPRVQQ 399
            ..|||:.| :::.:..:....:....:|: ||..|..|..::
Yeast   303 AAIDAQNT-MKELEKMKEASTNNEPLFDK-DGNEQIKPTTEE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 106/428 (25%)
DnaJ 7..65 CDD:278647 33/60 (55%)
DnaJ_C 112..336 CDD:199909 47/252 (19%)
DnaJ_zf 140..206 CDD:199908 15/76 (20%)
DJP1NP_012269.1 PRK10767 7..>97 CDD:236757 44/94 (47%)
DnaJ-X 208..422 CDD:405064 30/175 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.