DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AT1G80030

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_565227.1 Gene:AT1G80030 / 844343 AraportID:AT1G80030 Length:500 Species:Arabidopsis thaliana


Alignment Length:351 Identity:129/351 - (36%)
Similarity:183/351 - (52%) Gaps:27/351 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPD--KNPNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||..|||..:|...|:|.|||:||.:||||  |.|...||||.||.|||||||..||.:||:.||
plant    76 YYATLGVSKSANNKEIKAAYRRLARQYHPDVNKEPGATEKFKEISAAYEVLSDEQKRALYDQYGE 140

  Fly    70 AAIKK--GGADSGDFRNPMDFFEKFFGAGFGGSGG------GRRRERR---GKDVVHQMSVQLEE 123
            |.:|.  |||......||.|.||.||||..||..|      ||.|..|   |:|:.:.::::|.|
plant   141 AGVKSTVGGASGPYTSNPFDLFETFFGASMGGFPGMDQADFGRTRRSRVTKGEDLRYDITLELSE 205

  Fly   124 LYNGATRKLQLQKNVICDKCEGRGGKKGS-IEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCS 187
            ...|:.::..|.....|:.|.|.|.|.|| :..|..|.|.|...|.:|...|:...: .:|..|.
plant   206 AIFGSEKEFDLTHLETCEACAGTGAKAGSKMRICSTCGGRGQVMRTEQTPFGMFSQV-SICPNCG 269

  Fly   188 GTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPE-SQPGDIIILLDE 251
            |.||.|.|  .|:.|||...||.:|.::|.|..|:..|..:...||||..|. ..|||:.:.||.
plant   270 GDGEVISE--NCRKCSGEGRVRIKKSIKVKIPPGVSAGSILRVAGEGDSGPRGGPPGDLYVYLDV 332

  Fly   252 KEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLD-DRDLIV--STQPGEVIRHEMTKCIAEEG 313
            ::.......|.:|:..:.:..::|:.|....|||:: |.:|.:  .||||:|:      .:|::|
plant   333 EDVRGIERDGINLLSTLSISYLDAILGAVVKVKTVEGDTELQIPPGTQPGDVL------VLAKKG 391

  Fly   314 MPIFKNPMEKGTLIIQFEVIFPEVIN 339
            :|....|..:|..:...:|..|..|:
plant   392 VPKLNRPSIRGDHLFTVKVSVPNQIS 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 129/351 (37%)
DnaJ 7..65 CDD:278647 34/59 (58%)
DnaJ_C 112..336 CDD:199909 67/228 (29%)
DnaJ_zf 140..206 CDD:199908 25/66 (38%)
AT1G80030NP_565227.1 PRK14293 74..436 CDD:237663 129/351 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X359
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.