DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AT1G56300

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_564717.1 Gene:AT1G56300 / 842083 AraportID:AT1G56300 Length:156 Species:Arabidopsis thaliana


Alignment Length:134 Identity:43/134 - (32%)
Similarity:65/134 - (48%) Gaps:30/134 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TGYYDILGVKPNATPDELKKAYRKLALKYHPD---KNPN-EGE---KFKAISQAYEVLSDADKRQ 62
            :.||.|||::.:|:..:::.||||||:|:|||   :||. .||   :|:.|.:||.||:|.:||.
plant    12 SSYYTILGIRKDASVSDIRTAYRKLAMKWHPDRYARNPGVAGEAKRRFQQIQEAYSVLNDENKRS 76

  Fly    63 VYDEGGEAAIKKGGADSGDFRNPM--------------DFFEKFFGAGFGGSG---------GGR 104
            :||.|.....:....|..||...|              :..::.|....||.|         .|.
plant    77 MYDVGLYDPHEDDDDDFCDFMQEMISMMNNVKDAGESLEDLQRMFTDMVGGDGVSYDCNNNPKGN 141

  Fly   105 RRER 108
            :|.|
plant   142 KRPR 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 43/134 (32%)
DnaJ 7..65 CDD:278647 29/64 (45%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
AT1G56300NP_564717.1 DnaJ 13..79 CDD:278647 29/65 (45%)
DnaJ 13..>79 CDD:223560 29/65 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.