DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AT1G44160

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_175080.2 Gene:AT1G44160 / 841019 AraportID:AT1G44160 Length:357 Species:Arabidopsis thaliana


Alignment Length:219 Identity:52/219 - (23%)
Similarity:89/219 - (40%) Gaps:70/219 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LEELYNGATRKLQLQKNVIC---DKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQV 182
            ||||.||.|:|::::::||.   :|||                                      
plant   188 LEELCNGCTKKIKIKRDVITSLGEKCE-------------------------------------- 214

  Fly   183 CRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIII 247
                                       |.:::|:.::.|.:.|.|:.|.|:|:....|.|.|:..
plant   215 ---------------------------EEEMVEIKVKPGWKGGTKVTFEGKGNEAMRSVPADLTF 252

  Fly   248 LLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEE 312
            ::.||||..|...|.||.|.:.:.|:|||.|.:..|..||..::.:..:  :||.......:..:
plant   253 VIVEKEHEVFKREGDDLEMAVEVSLLEALTGCELSVALLDGDNMRLRIE--DVIHPGYVTVVQGK 315

  Fly   313 GMPIFKNPMEKGTLIIQFEVIFPE 336
            |||..|...::|.|.::|...||:
plant   316 GMPNLKEKGKRGDLRVRFRTKFPQ 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 52/219 (24%)
DnaJ 7..65 CDD:278647
DnaJ_C 112..336 CDD:199909 51/217 (24%)
DnaJ_zf 140..206 CDD:199908 3/68 (4%)
AT1G44160NP_175080.2 DnaJ_C 178..341 CDD:199909 52/219 (24%)
DnaJ <221..357 CDD:223560 37/121 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.