DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Droj2 and J11

DIOPT Version :9

Sequence 1:	NP_650283.1	Gene:	Droj2 / 41646	FlyBaseID:	FBgn0038145	Length:	403	Species:	Drosophila melanogaster
Sequence 2:	NP_195328.1	Gene:	J11 / 829760	AraportID:	AT4G36040	Length:	161	Species:	Arabidopsis thaliana

Alignment Length:	64	Identity:	27/64 - (42%)
Similarity:	36/64 - (56%)	Gaps:	6/64 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly     8 YDILGVKPNATPDELKKAYRKLALKYHPD------KNPNEGEKFKAISQAYEVLSDADKRQVYD 65
            ||:|.|...||..::|.|||:||...|||      .:.:..::|..|..||..|||.:||.|||
plant    67 YDVLEVPLGATSQDIKSAYRRLARICHPDVAGTDRTSSSSADEFMKIHAAYCTLSDPEKRSVYD 130

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Droj2	NP_650283.1	PTZ00037	2..398	CDD:240236	27/64 (42%)
		DnaJ	7..65	CDD:278647	25/62 (40%)
		DnaJ_C	112..336	CDD:199909
		DnaJ_zf	140..206	CDD:199908
J11	NP_195328.1	DnaJ	65..130	CDD:395170	25/62 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0712
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810