DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and J20

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_193119.1 Gene:J20 / 827017 AraportID:AT4G13830 Length:197 Species:Arabidopsis thaliana


Alignment Length:141 Identity:42/141 - (29%)
Similarity:66/141 - (46%) Gaps:37/141 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNE-----GEKFKAISQAYEVLSDADKRQ 62
            ::..:||:|||..:.|..|:|:||::||.|||||.:|.:     .::|..:.:|||.|||..:|.
plant    63 EDLSFYDLLGVTESVTLPEIKQAYKQLARKYHPDVSPPDRVEEYTDRFIRVQEAYETLSDPRRRV 127

  Fly    63 VYDEGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMS-------VQ 120
            :||                         :....||..|..|||:.|..::||.:.|       .|
plant   128 LYD-------------------------RDLSMGFSFSFSGRRQNRYDQEVVEEKSEWKAKWQTQ 167

  Fly   121 LEELYNGATRK 131
            |..|...:.:|
plant   168 LSGLRRRSNQK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 42/141 (30%)
DnaJ 7..65 CDD:278647 26/62 (42%)
DnaJ_C 112..336 CDD:199909 7/27 (26%)
DnaJ_zf 140..206 CDD:199908
J20NP_193119.1 DnaJ 66..>143 CDD:223560 31/101 (31%)
DnaJ 66..130 CDD:278647 26/63 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.