DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and ATERDJ3B

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_191819.1 Gene:ATERDJ3B / 825434 AraportID:AT3G62600 Length:346 Species:Arabidopsis thaliana


Alignment Length:357 Identity:134/357 - (37%)
Similarity:190/357 - (53%) Gaps:55/357 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE---KFKAISQAYEVLSDADKRQVYDEGG 68
            |||:|.|...|:.:::|:||||||||||||||....|   ||..|:.|||||||.:||::|::.|
plant    27 YYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSDEEKREIYNKYG 91

  Fly    69 EAAIK-------KGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYN 126
            |..:|       :||...|  .|..|.|..|||   |||.....:..:|.||:.::...||:||.
plant    92 EEGLKQFSANGGRGGGGGG--MNMQDIFSSFFG---GGSMEEEEKVVKGDDVIVELEATLEDLYM 151

  Fly   127 GATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHI-EQVCRKCSGTG 190
            |.:.|:..:||||    :...||:    || .||.   |...:||.||:.|.: ||||       
plant   152 GGSMKVWREKNVI----KPAPGKR----KC-NCRN---EVYHRQIGPGMFQQMTEQVC------- 197

  Fly   191 ETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHS 255
                  |:|.|.   |..||...:.|.|||||:||:::.|..:|:...:..|||:...:....|:
plant   198 ------DKCPNV---KYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGDPGDLKFRIRTAPHA 253

  Fly   256 TFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVS----TQPGEVIRHEMTKCIAEEGMPI 316
            .|...|.||.|.:.:.|||||.||::..|.|||.::.:|    |:|.||      |....||||:
plant   254 RFRRDGNDLHMNVNITLVEALVGFEKSFKHLDDHEVDISSKGITKPKEV------KKFKGEGMPL 312

  Fly   317 FKNPMEKGTLIIQFEVIFPEVINPSVVPTLKQ 348
            ..: .:||.|.:.|||:||..:.......:|:
plant   313 HYS-TKKGNLFVTFEVLFPSSLTDDQKKKIKE 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 134/357 (38%)
DnaJ 7..65 CDD:278647 34/60 (57%)
DnaJ_C 112..336 CDD:199909 81/228 (36%)
DnaJ_zf 140..206 CDD:199908 19/66 (29%)
ATERDJ3BNP_191819.1 DnaJ 23..343 CDD:223560 133/355 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.