DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AT3G62190

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_191778.1 Gene:AT3G62190 / 825392 AraportID:AT3G62190 Length:138 Species:Arabidopsis thaliana


Alignment Length:76 Identity:30/76 - (39%)
Similarity:41/76 - (53%) Gaps:10/76 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILGVKPNATPD--ELKKAYRKLALKYHPDKNPNEGE-----KFKAISQAYEVLSDAD-KRQVYDE 66
            :||..||:.||  ::|.||||...:.|||..|::.:     |||:||:||..|...| |.|.|..
plant     9 LLGFPPNSRPDPSQVKAAYRKKVWESHPDLFPDDQKLVAESKFKSISEAYSCLESGDVKGQWYYR 73

  Fly    67 GG--EAAIKKG 75
            .|  ...:|.|
plant    74 AGVYSRVVKTG 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 30/76 (39%)
DnaJ 7..65 CDD:278647 26/62 (42%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
AT3G62190NP_191778.1 DnaJ 9..65 CDD:197617 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.