powered by:
Protein Alignment Droj2 and AT3G62190
DIOPT Version :9
Sequence 1: | NP_650283.1 |
Gene: | Droj2 / 41646 |
FlyBaseID: | FBgn0038145 |
Length: | 403 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_191778.1 |
Gene: | AT3G62190 / 825392 |
AraportID: | AT3G62190 |
Length: | 138 |
Species: | Arabidopsis thaliana |
Alignment Length: | 76 |
Identity: | 30/76 - (39%) |
Similarity: | 41/76 - (53%) |
Gaps: | 10/76 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 ILGVKPNATPD--ELKKAYRKLALKYHPDKNPNEGE-----KFKAISQAYEVLSDAD-KRQVYDE 66
:||..||:.|| ::|.||||...:.|||..|::.: |||:||:||..|...| |.|.|..
plant 9 LLGFPPNSRPDPSQVKAAYRKKVWESHPDLFPDDQKLVAESKFKSISEAYSCLESGDVKGQWYYR 73
Fly 67 GG--EAAIKKG 75
.| ...:|.|
plant 74 AGVYSRVVKTG 84
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.