DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AT3G57340

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_191293.1 Gene:AT3G57340 / 824901 AraportID:AT3G57340 Length:367 Species:Arabidopsis thaliana


Alignment Length:146 Identity:51/146 - (34%)
Similarity:75/146 - (51%) Gaps:27/146 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGG- 68
            ||:|||::.|.:.|:::||||||:||.|||||  |...|.||::|:|::.||:.:.|:.||..| 
plant   114 YYEILGLESNCSVDDVRKAYRKLSLKVHPDKNQAPGSEEAFKSVSKAFQCLSNDEARKKYDVSGS 178

  Fly    69 -------EAAIKKGGADSG----DFRNPMDFFEKFF-GAGFGGSGGGRRRERRGKDVVHQMSVQL 121
                   ..:.:..|.:.|    |..:|.:.|..|| |.||||.|            :...:.|.
plant   179 DEPIYQPRRSARSNGFNGGYYYEDEFDPNEIFRSFFGGGGFGGGG------------MPPATAQF 231

  Fly   122 EELYNGATRKLQLQKN 137
            .....||||:.....|
plant   232 RSFNFGATRQRTANNN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 51/146 (35%)
DnaJ 7..65 CDD:278647 29/59 (49%)
DnaJ_C 112..336 CDD:199909 6/26 (23%)
DnaJ_zf 140..206 CDD:199908
AT3G57340NP_191293.1 DnaJ 109..>210 CDD:223560 36/95 (38%)
DnaJ 113..174 CDD:278647 29/59 (49%)
DUF1977 277..361 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.