DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AT3G47940

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_190377.1 Gene:AT3G47940 / 823949 AraportID:AT3G47940 Length:350 Species:Arabidopsis thaliana


Alignment Length:406 Identity:118/406 - (29%)
Similarity:174/406 - (42%) Gaps:126/406 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNP----NEGE-KFKAISQAYEVLSDADKRQVYDE 66
            ||:||.|..|||.|:|||||::||:.:||||||    :|.| |||.||:||:||||..|||:||.
plant     5 YYNILKVNHNATEDDLKKAYKRLAMIWHPDKNPSTRRDEAEAKFKRISEAYDVLSDPQKRQIYDL 69

  Fly    67 GGEAAIKKG-------------------------------GADSGDFR-NPM---DFFEKFFGAG 96
            .||..:|.|                               ..::..|| ||.   |.:.:|||:.
plant    70 YGEEGLKSGKIPNSSSSEASSSSSSSSSRYPHFHQHRPQHPPNASSFRFNPRDAEDIYAEFFGSE 134

  Fly    97 FGG-----SGGGRRRERRG-----------------KDVVHQMSVQLEELYNGATRKLQLQKNVI 139
            .||     .|.|.|..|.|                 ..:.:.:.|.||:||.|..:|:::.:||.
plant   135 NGGGSNNAGGRGNRAFRNGHFNTGGANGYSGEMRKVPAMENPLPVSLEDLYKGVVKKMRITRNVY 199

  Fly   140 CDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSG 204
                                                                         :.||
plant   200 -------------------------------------------------------------DASG 203

  Fly   205 RKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMP 269
            |..| |.::|.:.|:.|.:.|.|:.|..:|:.||...|.||:.:::||.|..:...|.||::...
plant   204 RMMV-EAEILPIEIKPGWKKGTKLTFPKKGNEEPGIIPADIVFVVEEKPHPVYKRDGNDLLVSQE 267

  Fly   270 LQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIF 334
            :.|:|||.|....:.|||.|.|::...  |:|:.:....:..|||||.|.|.:||.|.::..|.:
plant   268 ITLLEALTGKTVNLITLDGRTLMIPLT--EIIKPDHEIVVPNEGMPISKEPGKKGNLKLKLSVKY 330

  Fly   335 PEVINPSVVPTLKQCL 350
            |..:.......||:.|
plant   331 PSRLTSDQKFELKRVL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 118/406 (29%)
DnaJ 7..65 CDD:278647 38/62 (61%)
DnaJ_C 112..336 CDD:199909 55/223 (25%)
DnaJ_zf 140..206 CDD:199908 2/65 (3%)
AT3G47940NP_190377.1 DnaJ 1..344 CDD:223560 116/402 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.