DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AT3G14200

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_188036.1 Gene:AT3G14200 / 820637 AraportID:AT3G14200 Length:230 Species:Arabidopsis thaliana


Alignment Length:223 Identity:54/223 - (24%)
Similarity:88/223 - (39%) Gaps:41/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDILGVKPNATPDELKKAYRKLALKYHPDKNPN------EGEKFKAISQAYEVLSDADKRQVYDE 66
            |.:||:|...:..||:.||:||||::|||:..:      ..:||:||.:||.||||::||.:||.
plant    14 YAVLGLKKECSKTELRSAYKKLALRWHPDRCSSMEFVEEAKKKFQAIQEAYSVLSDSNKRFLYDV 78

  Fly    67 GGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYNG---- 127
            |..      ..|..|.:|.|..|..........|   :..:....|...|:.....|::.|    
plant    79 GAY------NTDDDDDQNGMGDFLNEMATMMNQS---KPSDNNTGDSFEQLQDLFNEMFQGDAAA 134

  Fly   128 -------ATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRK 185
                   :|......::.:.|....|.....:....:.....|.:.|....:.|:          
plant   135 FPSSSSCSTSNFTSSRSFVFDTNSQRSSSFATSSMGMNNDPFGYDPRAHSFSLGV---------- 189

  Fly   186 CSGTGETIQEKDRCKNCSGRKTVRERKV 213
                 :..||..:.||..||:..|:..|
plant   190 -----DHQQEFKKGKNNGGRRNRRKNNV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 54/223 (24%)
DnaJ 7..65 CDD:278647 27/62 (44%)
DnaJ_C 112..336 CDD:199909 18/113 (16%)
DnaJ_zf 140..206 CDD:199908 10/65 (15%)
AT3G14200NP_188036.1 DnaJ 12..77 CDD:395170 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.