DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Droj2 and AT3G13310

DIOPT Version :9

Sequence 1:	NP_650283.1	Gene:	Droj2 / 41646	FlyBaseID:	FBgn0038145	Length:	403	Species:	Drosophila melanogaster
Sequence 2:	NP_187939.1	Gene:	AT3G13310 / 820531	AraportID:	AT3G13310	Length:	157	Species:	Arabidopsis thaliana

Alignment Length:	58	Identity:	25/58 - (43%)
Similarity:	35/58 - (60%)	Gaps:	0/58 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     8 YDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYD 65
            |::|.|...|:..|:|.|||.||..||||.:.::|..|..|.:||..|:|...|.:||
plant    66 YELLKVNETASLTEIKTAYRSLAKVYHPDASESDGRDFMEIHKAYATLADPTTRAIYD 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Droj2	NP_650283.1	PTZ00037	2..398	CDD:240236	25/58 (43%)
		DnaJ	7..65	CDD:278647	23/56 (41%)
		DnaJ_C	112..336	CDD:199909
		DnaJ_zf	140..206	CDD:199908
AT3G13310	NP_187939.1	DnaJ	64..123	CDD:278647	23/56 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0712
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810