DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AT3G12170

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001325582.1 Gene:AT3G12170 / 820394 AraportID:AT3G12170 Length:298 Species:Arabidopsis thaliana


Alignment Length:154 Identity:53/154 - (34%)
Similarity:77/154 - (50%) Gaps:35/154 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNE---GEKFKAISQAYEVLSDADKRQVYD 65
            |...|::|||:..|:|.|::|||.||||:.|||||.::   .|||:.:.:...:|.|.:||.|||
plant    45 EKNLYEVLGVEATASPQEIRKAYHKLALRLHPDKNKDDEDAKEKFQQLQKVISILGDEEKRAVYD 109

  Fly    66 EGGEAAIKKGGAD-SGD-FRNPMDFFEKF-----------FGAGFGGSGGGRRRERRGKDVVHQM 117
            :.|..    ..|| ||| ..|..|||:..           |.|.:.||      |....|::   
plant   110 QTGSV----DDADLSGDVVDNLRDFFKAMYKKVTEEDIEEFEANYRGS------ESEKNDLI--- 161

  Fly   118 SVQLEELYNGATRKL-QLQKNVIC 140
                 ||||....|: :|..:::|
plant   162 -----ELYNKFKGKMSRLFCSMLC 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 53/154 (34%)
DnaJ 7..65 CDD:278647 27/60 (45%)
DnaJ_C 112..336 CDD:199909 8/30 (27%)
DnaJ_zf 140..206 CDD:199908 1/1 (100%)
AT3G12170NP_001325582.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.