DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AT3G08910

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_187503.1 Gene:AT3G08910 / 820040 AraportID:AT3G08910 Length:323 Species:Arabidopsis thaliana


Alignment Length:365 Identity:118/365 - (32%)
Similarity:167/365 - (45%) Gaps:100/365 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE----KFKAISQAYEVLSDADKRQVYDEG 67
            ||.:|.|..||..|:|||||||||:|:|||||||..:    |||.||:||:||||..||.:||:.
plant     5 YYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDVLSDPQKRAIYDQY 69

  Fly    68 GEAAIKK---------GGADSG-----DFRNPMDFFEKFFG--------AGFGGSGGGRRRE--- 107
            ||..:..         |.:|.|     :.|:..|.|.:|||        .|.|.|.|.|..|   
plant    70 GEEGLTSQAPPPGAGGGFSDGGASFRFNGRSADDIFSEFFGFTRPFGDSRGAGPSNGFRFAEDVF 134

  Fly   108 -------RRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVE 165
                   |:...:..|:...||:||.|.::|:::.::|:                          
plant   135 SSNVVPPRKAAPIERQLPCSLEDLYKGVSKKMKISRDVL-------------------------- 173

  Fly   166 TRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVF 230
                                               :.|||.|..| ::|.:.|:.|.:.|.||.|
plant   174 -----------------------------------DSSGRPTTVE-EILTIEIKPGWKKGTKITF 202

  Fly   231 TGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVST 295
            ..:|:.:....|.|::.::|||.|:.|...|.||:|...:.|||||.|:...|.|||.|.:.|..
plant   203 PEKGNEQRGIIPSDLVFIVDEKPHAVFKRDGNDLVMTQKIPLVEALTGYTAQVSTLDGRSVTVPI 267

  Fly   296 QPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFP 335
              ..||.....:.:..|||||.|:|.:||.|.|:|.|.||
plant   268 --NNVISPSYEEVVKGEGMPIPKDPSKKGNLRIKFTVKFP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 118/365 (32%)
DnaJ 7..65 CDD:278647 37/61 (61%)
DnaJ_C 112..336 CDD:199909 61/224 (27%)
DnaJ_zf 140..206 CDD:199908 2/65 (3%)
AT3G08910NP_187503.1 DnaJ 1..313 CDD:223560 118/365 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.