DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AT2G22360

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_565533.1 Gene:AT2G22360 / 816768 AraportID:AT2G22360 Length:442 Species:Arabidopsis thaliana


Alignment Length:343 Identity:113/343 - (32%)
Similarity:173/343 - (50%) Gaps:21/343 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ETGYYDILGVKPNATPDELKKAYRKLALKYHPD--KNPNEGEKFKAISQAYEVLSDADKRQVYDE 66
            :..||.:|||..|||..|:|.||||||..||||  |:|...||||.||.|||||||.:|:.:||.
plant    84 DADYYSVLGVSKNATKAEIKSAYRKLARNYHPDVNKDPGAEEKFKEISNAYEVLSDDEKKSLYDR 148

  Fly    67 GGEAAIK-KGGADSGDFRNPMDFFEKFFGAGFGG--SGGGRRRERRGKDVVHQMSVQLEELYNGA 128
            .|||.:| ..|..:|||.||.|.|:..| .||||  ..|.|.|...|:|..:.:.:..:|...|.
plant   149 YGEAGLKGAAGFGNGDFSNPFDLFDSLF-EGFGGGMGRGSRSRAVDGQDEYYTLILNFKEAVFGM 212

  Fly   129 TRKLQLQKNVICDKCEGRGGKKGS-IEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGET 192
            .:::::.:...|..|||.|.|.|: ..||..|.|.|......:...|:.|.: ..|..|:||||.
plant   213 EKEIEISRLESCGTCEGSGAKPGTKPTKCTTCGGQGQVVSAARTPLGVFQQV-MTCSSCNGTGEI 276

  Fly   193 IQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGD-HEPESQPGDIIILLDEKEHST 256
               ...|..|||...||:.|.:.:.:..|:..|.::...|||: .:....|||:.::::......
plant   277 ---STPCGTCSGDGRVRKTKRISLKVPAGVDSGSRLRVRGEGNAGKRGGSPGDLFVVIEVIPDPI 338

  Fly   257 FAHAGQDLMMKMPLQLVEALCGFQRIVKTLD---DRDLIVSTQPGEVIRHEMTKCIAEEGMPIFK 318
            ......:::....:..::|:.|....|.|:|   |..:...|||      ..|..:|::|:|:..
plant   339 LKRDDTNILYTCKISYIDAILGTTLKVPTVDGTVDLKVPAGTQP------STTLVMAKKGVPVLN 397

  Fly   319 NPMEKGTLIIQFEVIFPE 336
            ....:|..:::.:|..|:
plant   398 KSNMRGDQLVRVQVEIPK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 113/343 (33%)
DnaJ 7..65 CDD:278647 36/59 (61%)
DnaJ_C 112..336 CDD:199909 53/228 (23%)
DnaJ_zf 140..206 CDD:199908 24/66 (36%)
AT2G22360NP_565533.1 DnaJ_bact 86..432 CDD:274090 113/341 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X359
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.