| Sequence 1: | NP_650283.1 | Gene: | Droj2 / 41646 | FlyBaseID: | FBgn0038145 | Length: | 403 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001026893.1 | Gene: | DNAJB14 / 79982 | HGNCID: | 25881 | Length: | 379 | Species: | Homo sapiens |
| Alignment Length: | 212 | Identity: | 66/212 - (31%) |
|---|---|---|---|
| Similarity: | 91/212 - (42%) | Gaps: | 56/212 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
Fly 70 AAIKKGGADSGDFR---------NPMDFFEKFFGAGF-GGSGGGRRRERRGKDVVHQMSVQLEEL 124
Fly 125 YNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKC--- 186
Fly 187 ---------SGTGETIQ 194 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Droj2 | NP_650283.1 | PTZ00037 | 2..398 | CDD:240236 | 66/212 (31%) |
| DnaJ | 7..65 | CDD:278647 | 33/59 (56%) | ||
| DnaJ_C | 112..336 | CDD:199909 | 16/95 (17%) | ||
| DnaJ_zf | 140..206 | CDD:199908 | 12/67 (18%) | ||
| DNAJB14 | NP_001026893.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 55..94 | ||
| DnaJ | 107..>214 | CDD:223560 | 46/104 (44%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 219..241 | 6/27 (22%) | |||
| DUF1977 | 271..371 | CDD:370429 | 6/18 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||