DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Samd13

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_083420.2 Gene:Samd13 / 75015 MGIID:2686498 Length:234 Species:Mus musculus


Alignment Length:254 Identity:66/254 - (25%)
Similarity:105/254 - (41%) Gaps:67/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNE----GEKFKAISQAYEVLSDADKRQVYDEG 67
            ||.:|||..||:..::|:|:.:|||:.||||||.:    .||||.:::||.:||||.||:.||..
Mouse     4 YYKVLGVPRNASSSDIKRAFHQLALQVHPDKNPGDKEAAEEKFKQVAEAYHILSDAKKRKDYDRS 68

  Fly    68 ----GEAAIKKGGADSG------DFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLE 122
                .:..|:..|.|.|      |.|:..|:.||...          ||.|.    ..|...:.|
Mouse    69 RWNRNKGEIRGDGHDKGETIRVNDSRDETDWEEKICS----------RRPRH----TFQKVTEDE 119

  Fly   123 ELYNGATRKLQLQKNVICDKCEGRGGKKGS---------------------IEKCLQCRGNGVET 166
            :|::|              .|...|...||                     :....:...:..||
Mouse   120 DLFSG--------------DCLFSGPITGSRRASSPFFTVTPIMDTGFSTFVSHESRSYSDDPET 170

  Fly   167 RVQQIAPGIMQHIEQVCRKCSGT--GETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMR 223
            .|..|:.|:.:.  ::...||.|  |:.:..|...:|..|.|.:...::...:..:|.:
Mouse   171 FVPYISQGMGKF--RLVTTCSKTVNGKRVVTKRVVENIRGPKKIENERLFRHNPSRGWK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 66/254 (26%)
DnaJ 7..65 CDD:278647 30/61 (49%)
DnaJ_C 112..336 CDD:199909 22/135 (16%)
DnaJ_zf 140..206 CDD:199908 16/88 (18%)
Samd13NP_083420.2 DnaJ 2..>67 CDD:223560 31/62 (50%)
DnaJ 3..66 CDD:278647 30/61 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.