DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajb7

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001123982.1 Gene:Dnajb7 / 685839 RGDID:1589047 Length:303 Species:Rattus norvegicus


Alignment Length:300 Identity:75/300 - (25%)
Similarity:118/300 - (39%) Gaps:90/300 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE----KFKAISQAYEVLSDADKRQVYDEG 67
            ||::|||:..|:|:::|:||||:|||:||||||...|    |||.:::||||||:.:||.:||:.
  Rat     4 YYEVLGVQRYASPEDIKRAYRKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNGEKRDIYDKY 68

  Fly    68 GEAAIKKGGADSGD--------FRNPMDFFEKFFG-------------------AGFGGSGGGRR 105
            |:..:..||....|        ||...|.|::.||                   :....||...|
  Rat    69 GKEGLTGGGGSHLDDEREYGFTFRKADDVFKEIFGERDPFSFHFFEDSLADLLSSSRSSSGSRSR 133

  Fly   106 RERRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQ 170
            .....:...:.:..:|.....|.:..:.                          ||:...|.|..
  Rat   134 GSLFSRSYDYPVFARLSSYDTGYSPYVS--------------------------RGHESLTSVSS 172

  Fly   171 IA---PGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTG 232
            :|   ||:..:|.......:|           :|...:||...|:..:|..:..:|   ..:...
  Rat   173 LAFEDPGVGNYIPITPSVING-----------RNVKTKKTFENRQERKVEDDSELR---SFLVNE 223

  Fly   233 EG-------------DHEPESQPGDIII---LLDEKEHST 256
            ||             |:.|.|.......   |:|:||..|
  Rat   224 EGFADKCNWRRQSFNDYSPNSYTHSSTTQYSLVDDKEQGT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 74/299 (25%)
DnaJ 7..65 CDD:278647 33/61 (54%)
DnaJ_C 112..336 CDD:199909 26/163 (16%)
DnaJ_zf 140..206 CDD:199908 10/68 (15%)
Dnajb7NP_001123982.1 DnaJ 3..66 CDD:278647 33/61 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.