powered by:
Protein Alignment Droj2 and Dnajb2
DIOPT Version :9
Sequence 1: | NP_650283.1 |
Gene: | Droj2 / 41646 |
FlyBaseID: | FBgn0038145 |
Length: | 403 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_036008391.1 |
Gene: | Dnajb2 / 56812 |
MGIID: | 1928739 |
Length: | 365 |
Species: | Mus musculus |
Alignment Length: | 50 |
Identity: | 19/50 - (38%) |
Similarity: | 27/50 - (54%) |
Gaps: | 13/50 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 KRQVYD----EG------GEAAIKKGGADSG---DFRNPMDFFEKFFGAG 96
||::|| || |.:..:.|||..| .||:|.:.|.:|||:|
Mouse 102 KREIYDRYGREGLTGAGSGPSRSETGGAGPGFTFTFRSPEEVFREFFGSG 151
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.