DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and AgaP_AGAP005908

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_001688751.1 Gene:AgaP_AGAP005908 / 5667045 VectorBaseID:AGAP005908 Length:403 Species:Anopheles gambiae


Alignment Length:392 Identity:83/392 - (21%)
Similarity:149/392 - (38%) Gaps:107/392 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDK-----NPNE---------GEKFKAISQAYEVL-- 55
            :|.:|||...|:.:::||||.:||.::|||:     |.|.         .:||..|::|||.|  
Mosquito    60 FYAVLGVSRTASFNDIKKAYYELAKQFHPDRRTAQQNSNSTAKESTAAMEKKFSQITEAYEALLV 124

  Fly    56 -----------------SDADKRQVYDEGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGG 103
                             .|..|:.:       .:.|.| .||:...|....              
Mosquito   125 EVKHRTESVVDLNPSLYRDLQKKHM-------LLPKNG-QSGNTAPPTTLI-------------- 167

  Fly   104 RRRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSIEK--CLQCRGNGVET 166
              .|...:|||  :::..:|...|..|:|.|...|.||:|...|.:.....:  |..|.|.|.:.
Mosquito   168 --NELNYEDVV--LTLTFKESIEGTVRELTLPIGVKCDRCSYTGTQSALDPEGLCSICHGTGKQE 228

  Fly   167 RVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGM--RDGQKIV 229
            ...:....:|.     |:.|:|:..| ..|..|..|.|:..|.::..|.|.|.|..  :|..|:.
Mosquito   229 FHTESGKLLMP-----CKFCNGSKHT-PHKLTCPKCHGKGIVMKQHPLTVSIPKASQHKDRLKVR 287

  Fly   230 FTGEGDHEPESQPG---DIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLD---D 288
            .           ||   .:.::|..::...|...|.::.....:.:::|:.|....::.::   :
Mosquito   288 I-----------PGLQRQLTVILHVQDQGHFRRVGLNIYSTEEITMLKAIRGGDLSIRGINGIFN 341

  Fly   289 RDLIVSTQ-------PGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPEVINPSVVPTL 346
            ..|...||       ||:.:|.|:.:              :.|..|:..::..|..:.|..:..|
Mosquito   342 VYLEPGTQFGTELRIPGKGLRDELRQ--------------DVGDHILTLQIRLPRTLTPRQLQLL 392

  Fly   347 KQ 348
            ::
Mosquito   393 EE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 83/392 (21%)
DnaJ 7..65 CDD:278647 25/90 (28%)
DnaJ_C 112..336 CDD:199909 49/240 (20%)
DnaJ_zf 140..206 CDD:199908 17/67 (25%)
AgaP_AGAP005908XP_001688751.1 DnaJ 59..398 CDD:223560 83/392 (21%)
DnaJ 59..122 CDD:278647 22/61 (36%)
DnaJ_zf 200..262 CDD:304418 17/67 (25%)
DnaJ_C 263..384 CDD:199909 24/145 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.