DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and DNAJC11

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_060668.2 Gene:DNAJC11 / 55735 HGNCID:25570 Length:559 Species:Homo sapiens


Alignment Length:195 Identity:52/195 - (26%)
Similarity:82/195 - (42%) Gaps:52/195 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN-----PNEGEK-FKAISQAYEVLSDADKRQVYD 65
            ||.:|.|:..|:.:|||.|||:|.:.|||||:     .::.|: |..:.||||||||...|.:||
Human    15 YYSLLNVRREASSEELKAAYRRLCMLYHPDKHRDPELKSQAERLFNLVHQAYEVLSDPQTRAIYD 79

  Fly    66 EGGEAAIKKGGADSGD-FRNPMDFFEKFFGAGFGGSGGGRRRERR-----------------GKD 112
            ..|:..::..|.:..: .|.|.:..|:|       ....|.||.|                 ..|
Human    80 IYGKRGLEMEGWEVVERRRTPAEIREEF-------ERLQREREERRLQQRTNPKGTISVGVDATD 137

  Fly   113 VVHQMSVQLEELYNGATRKLQLQKNVICDKCE-------------------GRGGKKGSIEKCLQ 158
            :..:...:.|::...:..::::.|..|....|                   |.||  |||...|:
Human   138 LFDRYDEEYEDVSGSSFPQIEINKMHISQSIEAPLTATDTAILSGSLSTQNGNGG--GSINFALR 200

  Fly   159  158
            Human   201  200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 52/195 (27%)
DnaJ 7..65 CDD:278647 28/63 (44%)
DnaJ_C 112..336 CDD:199909 12/66 (18%)
DnaJ_zf 140..206 CDD:199908 8/38 (21%)
DNAJC11NP_060668.2 DnaJ 14..79 CDD:278647 28/63 (44%)
DUF3395 417..549 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.