DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and dnajb2

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_012825839.2 Gene:dnajb2 / 548454 XenbaseID:XB-GENE-951530 Length:361 Species:Xenopus tropicalis


Alignment Length:332 Identity:93/332 - (28%)
Similarity:130/332 - (39%) Gaps:120/332 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE----KFKAISQAYEVLSDADKRQVYDEG 67
            |||||||..||:.|::|:|||||||::||||||:..|    |||.|::|||||||.:||:.||. 
 Frog     4 YYDILGVPRNASQDDIKRAYRKLALRWHPDKNPDNKEHAERKFKDIAEAYEVLSDGEKREAYDN- 67

  Fly    68 GEAAIKKGGADSG---------------DFRNPMDFFEKFFG----------------------- 94
                :..|.:|.|               .||:|.|.|..|||                       
 Frog    68 ----MTSGFSDPGAFRATRVQRPFDFGFQFRSPEDVFRDFFGGKDPFPHMIGDDVFMFPNHPHGV 128

  Fly    95 -----------AGF----------GGSGGGRR--------RERRGKDVVHQM-------SVQLEE 123
                       :.|          ||.||.|.        :...||.:..:.       .:::||
 Frog   129 THHANSVPMFPSSFHFGNEFSFHSGGLGGSRNFCSVSTSTKFVNGKRITTKRIMENDVERIEVEE 193

  Fly   124 -------LYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAP---GIMQH 178
                   |.||....|.|.  |...|.|     :.|:.:. ..|.:|....:||.:|   .::|.
 Frog   194 DGELKSILVNGVEDDLALA--VELSKRE-----QASVPRA-SARTDGPSYNIQQRSPPGTPVVQD 250

  Fly   179 IE------QVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHE 237
            .:      |:...|| ..|..|.:...:.      ||.:|.|      |...|.|....|:..::
 Frog   251 RDDEDEELQLAMACS-LSEFEQSRQHPEG------VRSKKQL------GKDSGAKQQAKGQCGYK 302

  Fly   238 PESQPGD 244
            |..|.||
 Frog   303 PTLQEGD 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 93/332 (28%)
DnaJ 7..65 CDD:278647 38/61 (62%)
DnaJ_C 112..336 CDD:199909 34/156 (22%)
DnaJ_zf 140..206 CDD:199908 14/74 (19%)
dnajb2XP_012825839.2 PRK10767 3..>106 CDD:236757 50/106 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.