DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and DNAJB12

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001352009.1 Gene:DNAJB12 / 54788 HGNCID:14891 Length:377 Species:Homo sapiens


Alignment Length:153 Identity:62/153 - (40%)
Similarity:78/153 - (50%) Gaps:31/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||:||||...|:.::||||||:||||:|||||  |...|.||||..||.|||:.:||:.||:.|:
Human   111 YYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGD 175

  Fly    70 --AAIKKGGADSGDFR-------NPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELY 125
              :...:.|...|||.       :|.|.|..|||.||..|.            ||..|       
Human   176 DKSQAARHGHGHGDFHRGFEADISPEDLFNMFFGGGFPSSN------------VHVYS------- 221

  Fly   126 NGATRKLQLQKNVICDKCEGRGG 148
            ||..|....|:....|. :|.||
Human   222 NGRMRYTYQQRQDRRDN-QGDGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 62/153 (41%)
DnaJ 7..65 CDD:278647 35/59 (59%)
DnaJ_C 112..336 CDD:199909 11/37 (30%)
DnaJ_zf 140..206 CDD:199908 4/9 (44%)
DNAJB12NP_001352009.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..92
DnaJ 110..>236 CDD:333066 58/143 (41%)
DUF1977 268..368 CDD:312722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.