DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and dnajc4

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001007515.1 Gene:dnajc4 / 493241 XenbaseID:XB-GENE-994193 Length:233 Species:Xenopus tropicalis


Alignment Length:149 Identity:41/149 - (27%)
Similarity:72/149 - (48%) Gaps:20/149 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNE---GEKFKAISQAYEVLSDADKRQVYDEGG 68
            :|.:||::..||.:|:|.|:..::.|.|||.:|..   ..:|..:|:||:|||....|:.||:..
 Frog    33 HYQLLGIERKATSEEIKNAFFTMSKKLHPDSDPTNPLLHSQFVRLSEAYKVLSRDTSRREYDQLL 97

  Fly    69 EAAIKKG---GADSGDFRNP---------MDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQL 121
            :||.:..   ||.|..::.|         ..::.:|  |...|....||:.|.|:.|::.:.:..
 Frog    98 DAAQRDRWAYGARSSYYQGPSPSAAADENAHYWSQF--AARRGDPTQRRQGRNGRLVLYCLLIMA 160

  Fly   122 EEL---YNGATRKLQLQKN 137
            ..|   |.|.....::..|
 Frog   161 GSLTMHYVGFKTLREIHSN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 41/149 (28%)
DnaJ 7..65 CDD:278647 21/60 (35%)
DnaJ_C 112..336 CDD:199909 5/29 (17%)
DnaJ_zf 140..206 CDD:199908
dnajc4NP_001007515.1 DnaJ 32..94 CDD:278647 21/60 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.