DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and dnaja3b

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_958499.1 Gene:dnaja3b / 394242 ZFINID:ZDB-GENE-040115-3 Length:474 Species:Danio rerio


Alignment Length:380 Identity:95/380 - (25%)
Similarity:163/380 - (42%) Gaps:51/380 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNE---GEKFKAISQAYEVLSDADKRQVY 64
            ::..:|::|||...|:..|:||||.:||.|||||.||::   .|||..:::|||.|||..||:.|
Zfish    83 RQQDFYEVLGVPRTASQKEIKKAYYQLAKKYHPDTNPDDPDAKEKFAKLAEAYETLSDELKRKQY 147

  Fly    65 DEGGEAAIKKGGADSGDF------RNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEE 123
            |..|.|.....|.....:      .:|.:.|.|.||...||.|.|.......:.....|.:...:
Zfish   148 DTYGSAGPSASGTGQQQYWRGSANVDPEELFRKIFGEFAGGRGFGDINSMFDQAPEFVMELSFMQ 212

  Fly   124 LYNGATRKLQLQKNVICDKCEGRGGKKGS-IEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCS 187
            ...|..:::.:..:..|.:|:|:..:.|: :..|..|.|.|:|:  ....|.:|:   ..||:||
Zfish   213 AAKGVNKEITVNIDDDCPRCDGKAFEPGTKVSHCHYCNGTGMES--INTGPFMMR---SACRRCS 272

  Fly   188 GTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEK 252
            |.|..|...  |..|.|....::::.:.|.:..|:.|||.:.......|        :.|....:
Zfish   273 GRGFIIITP--CIMCRGSGQTKQKQTVMVPVPAGIADGQTVKVPVGKKH--------MYITFRVQ 327

  Fly   253 EHSTFAHAGQDLMMKMPLQLVEALCG----FQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEG 313
            :...|...|.|:...:.:.:.:|:.|    .|.:..|:|     ::..||....|::.  :..:|
Zfish   328 KSPVFRRDGADIHSDVLISIAQAILGGTARAQGLYSTID-----IAIPPGIQTDHKIK--LEGKG 385

  Fly   314 MPIFKNPMEKGTLIIQFEVIFPEVI--------------NPSVVPTLKQCLPPAP 354
            :|.. |....|...:..::..|:.:              ...|..|:.....|||
Zfish   386 IPRM-NSFGYGDHYVYIKIKIPKKLTRRQKMLLLSFAEDEEDVEGTVNGVTKPAP 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 95/380 (25%)
DnaJ 7..65 CDD:278647 30/60 (50%)
DnaJ_C 112..336 CDD:199909 45/228 (20%)
DnaJ_zf 140..206 CDD:199908 21/66 (32%)
dnaja3bNP_958499.1 DnaJ 85..428 CDD:223560 90/365 (25%)
DnaJ 86..148 CDD:278647 30/61 (49%)
DnaJ_C 203..409 CDD:199909 46/228 (20%)
DnaJ_zf 229..289 CDD:199908 21/66 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.