DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and CG7387

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster


Alignment Length:425 Identity:97/425 - (22%)
Similarity:161/425 - (37%) Gaps:123/425 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEG--EKFKAISQAYEVLSDADKRQVYDE-GG 68
            ||.:|||..:||..:::.|:..||.:||||...:|.  :.|:.:|.||.:|:|..||..||: ||
  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLGG 165

  Fly    69 ---EAAI---------------KKGGAD-----------SGDFRNPMDFFEKFFGAGFGGSGGGR 104
               |.|.               ||..:|           |.:|..|:||.|...|.        :
  Fly   166 IKDERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGC--------K 222

  Fly   105 RRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRG--------GKKGSIEKCLQCRG 161
            :|            ::|..|     ||        |:.|:|:.        ||    |.|.:|.|
  Fly   223 KR------------IELRYL-----RK--------CETCKGKSQLMAHRDVGK----EPCRRCNG 258

  Fly   162 NGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQ 226
            .|   :|....|....  ...|.:|.  |:....::.|:.||.|..|.....:.|.:..|.|||.
  Fly   259 TG---KVMTKTPTFSS--VNTCTQCK--GKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGD 316

  Fly   227 KIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDL 291
            .:...     .||::. .:...|.......|...|.|::....|.:.||:.|....::.|.: .:
  Fly   317 VVNII-----NPETKQ-QVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGLYE-SV 374

  Fly   292 IVSTQPGEVIRHEMTKCI-------AEEGMPIFKNPMEKGTLIIQFEVIFPEVINPSVVPTLKQC 349
            .:..:||   ....|:.:       :.||:         |..|:..:|..|.  |.||  ..:|.
  Fly   375 ELRVEPG---TQSHTQVVLNGKGVRSREGV---------GNHIVTLKVRIPR--NLSV--KQRQL 423

  Fly   350 LPPAPEVDIPIDAEQTVLEDFDPKQRRQQHQRMAY 384
            :....:.:.|:         |:||.:..:...:::
  Fly   424 VLALSQAEDPV---------FEPKTKSTEAGNLSH 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 97/425 (23%)
DnaJ 7..65 CDD:278647 23/59 (39%)
DnaJ_C 112..336 CDD:199909 48/238 (20%)
DnaJ_zf 140..206 CDD:199908 18/73 (25%)
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 93/396 (23%)
DnaJ 101..161 CDD:278647 23/59 (39%)
DnaJ_zf 233..296 CDD:199908 18/73 (25%)
DnaJ_C 298..416 CDD:199909 26/138 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.