DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and dnajc5aa

DIOPT Version :10

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001002464.1 Gene:dnajc5aa / 386768 ZFINID:ZDB-GENE-031113-20 Length:202 Species:Danio rerio


Alignment Length:68 Identity:36/68 - (52%)
Similarity:48/68 - (70%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE---KFKAISQAYEVLSDADKRQVYDEGGE 69
            |.:|||...||.|::||:||||||||||||||:..|   |||.|:.|:.:|:|..||.:||:.|.
Zfish    18 YHVLGVDKVATVDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILNDPTKRNIYDKYGS 82

  Fly    70 AAI 72
            ..:
Zfish    83 LGL 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 36/68 (53%)
dnajc5aaNP_001002464.1 DnaJ 16..78 CDD:395170 33/59 (56%)

Return to query results.
Submit another query.