DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and CG2790

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster


Alignment Length:99 Identity:41/99 - (41%)
Similarity:60/99 - (60%) Gaps:6/99 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNE----GEKFKAISQAYEVLSDADKRQVYDEG 67
            ||:.|.::.||...::|.||||:||::||||||:.    .|:|:.|.||||||||..:|..||..
  Fly     4 YYEELELQRNANDGDIKSAYRKMALRWHPDKNPDRLAEAKERFQLIQQAYEVLSDPQERSWYDNH 68

  Fly    68 GEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSG 101
            .|..::  |.:|....|.:|.|:.|..:.:.|.|
  Fly    69 REQILR--GKNSDYAENCLDVFQFFTSSCYKGYG 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 41/99 (41%)
DnaJ 7..65 CDD:278647 30/61 (49%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
CG2790NP_611986.2 DnaJ 3..66 CDD:278647 30/61 (49%)
ZUO1 19..>252 CDD:227594 36/84 (43%)
zf-C2H2_jaz 313..337 CDD:288983
C2H2 Zn finger 315..337 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.