DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and DNAJB13

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_011543306.1 Gene:DNAJB13 / 374407 HGNCID:30718 Length:350 Species:Homo sapiens


Alignment Length:373 Identity:99/373 - (26%)
Similarity:160/373 - (42%) Gaps:110/373 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGEAAIKKGGAD 78
            ::|.::..:.||:||||:||.|:  |:..|.|:.|::||:||||..||.:||:.||..: |||. 
Human    48 HSTAEDKDQRYRRLALKHHPLKSNEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFGEEGL-KGGI- 110

  Fly    79 SGDFRNPMDF-------------------FEKFFGA-----------------GFGGSGGGRRRE 107
                  |::|                   |.:|||.                 .|||. .||..:
Human   111 ------PLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGL-QGRGVK 168

  Fly   108 RRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIA 172
            ::...|...:.:.||:|:.|.|:|:::.:.|:.:                               
Human   169 KQDPQVERDLYLSLEDLFFGCTKKIKISRRVLNE------------------------------- 202

  Fly   173 PGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHE 237
                          .|...||::                |:|.:.::.|.|.|.:|.|..|||..
Human   203 --------------DGYSSTIKD----------------KILTIDVKPGWRQGTRITFEKEGDQG 237

  Fly   238 PESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIR 302
            |...|.|||.::.||.|..|.....:|....|:.|.:||......|:|||||  :::....::|.
Human   238 PNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDR--LLNIPINDIIH 300

  Fly   303 HEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPEVINPSVVPTLKQCL 350
            .:..|.:..||||:.::|.:||.|.|.|::.||..:.|.....|:|.|
Human   301 PKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 99/373 (27%)
DnaJ 7..65 CDD:278647 22/50 (44%)
DnaJ_C 112..336 CDD:199909 54/223 (24%)
DnaJ_zf 140..206 CDD:199908 3/65 (5%)
DNAJB13XP_011543306.1 DnaJ_bact 48..346 CDD:274090 97/369 (26%)
DnaJ 48..99 CDD:278647 22/50 (44%)
DnaJ_C 174..336 CDD:199909 55/224 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.