DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajc9

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001102335.1 Gene:Dnajc9 / 364240 RGDID:1305009 Length:259 Species:Rattus norvegicus


Alignment Length:253 Identity:53/253 - (20%)
Similarity:102/253 - (40%) Gaps:60/253 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDILGVKPNATPDELKKAYRKLALKYHPDK-----NPNEGEKFKAISQAYEVLSDADKRQVYDEG 67
            |.:|||:..|:..|:::.|.|::|:.|||:     ..:...:|:.:.:.|.||||.:::.||||.
  Rat    17 YQVLGVRREASDGEVRRGYHKVSLQVHPDRVKEDQKEDATRRFQILGRVYAVLSDKEQKAVYDEQ 81

  Fly    68 GEAAIKKGGADSGDFRNPMDF-------FEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQ-LEEL 124
            |..     ..||.......|:       |:|                      :....:| .|:.
  Rat    82 GTV-----DEDSAGLHQDRDWDAYWRLLFKK----------------------ISLEDIQAFEKT 119

  Fly   125 YNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQ---CRGNGVETRVQQIAPGIMQHIEQVCRKC 186
            |.|:..:|...|....|       .||.:::.::   |.....|.|::.|   |.:.|:  .::.
  Rat   120 YKGSEEELNDIKQAYLD-------FKGDMDQIMESVLCVQYTDEPRIRNI---IQKAID--AKEV 172

  Fly   187 SGTGETIQEKDRCKNCSGRKTVRERKVLEVH-----IEKGMRDGQKIVFTGEGDHEPE 239
            ......::|..:..|...|:...|.|..|:.     :|.|:...:.::.:.:.|.:.|
  Rat   173 PSYNAFVKESKQKMNARKRRAQEEAKEAELSRKELGLEGGVDSLKALIQSRQKDRQKE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 53/253 (21%)
DnaJ 7..65 CDD:278647 19/61 (31%)
DnaJ_C 112..336 CDD:199909 25/137 (18%)
DnaJ_zf 140..206 CDD:199908 11/68 (16%)
Dnajc9NP_001102335.1 DnaJ 15..79 CDD:278647 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.