DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajc11

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001102164.1 Gene:Dnajc11 / 362666 RGDID:1307731 Length:559 Species:Rattus norvegicus


Alignment Length:381 Identity:88/381 - (23%)
Similarity:139/381 - (36%) Gaps:121/381 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN-----PNEGEK-FKAISQAYEVLSDADKRQVYD 65
            ||.:|.|:..|:.:|||.|||:|.:.|||||:     .::.|: |..:.||||||||...|.:||
  Rat    15 YYSLLNVRREASAEELKAAYRRLCMLYHPDKHRDPELKSQAERLFNLVHQAYEVLSDPQTRAIYD 79

  Fly    66 ---------EGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQL 121
                     ||.|...:|        |.|.:..|:|           .|.:|..::         
  Rat    80 IYGKRGLEMEGWEVVERK--------RTPAEIREEF-----------ERLQREREE--------- 116

  Fly   122 EELYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKC 186
                    ||||.:.|           .||:|..       ||:      |..:....::.....
  Rat   117 --------RKLQQRTN-----------PKGTISV-------GVD------ATDLFDRYDEEYEDV 149

  Fly   187 SGTG---ETIQEKDRCKNCSGRKTVRERKVL--EVHIEKGMRDGQ-----KIVFTGEGDHEPESQ 241
            ||:|   ..|.:....::.....|..:..:|  .:..:.|...|.     :.|.:.:|..|.|..
  Rat   150 SGSGFPQIEINKMHISQSIEAPLTATDTAILSGSLSTQNGNGGGSINFALRRVTSAKGWGELEFG 214

  Fly   242 PGDIIILLDEKEHSTFAHAGQDLMMKM-PLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEM 305
            .||:       :...|   |..|...: |...|...|..|     ...|.:    :||      :
  Rat   215 AGDL-------QGPLF---GLKLFRNLTPRCFVTTNCALQ-----FSSRGI----RPG------L 254

  Fly   306 TKCIAEEGMPIFKNPMEKGTL-IIQFEVIFPEVINPSVVPTLKQC-LPPAPEVDIP 359
            |..:|..        ::|.|: .:|:.......:|.|:|...|.| ...|.::.||
  Rat   255 TTVLARN--------LDKNTVGYLQWRWGIQSAMNTSIVRDTKTCHFTVALQLGIP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 88/381 (23%)
DnaJ 7..65 CDD:278647 28/63 (44%)
DnaJ_C 112..336 CDD:199909 40/235 (17%)
DnaJ_zf 140..206 CDD:199908 10/68 (15%)
Dnajc11NP_001102164.1 DnaJ 14..79 CDD:278647 28/63 (44%)
Selenoprotein_S 372..>447 CDD:284376
DUF3395 417..549 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.