DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajb6

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006235925.1 Gene:Dnajb6 / 362293 RGDID:1308207 Length:364 Species:Rattus norvegicus


Alignment Length:246 Identity:70/246 - (28%)
Similarity:98/246 - (39%) Gaps:107/246 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE----KFKAISQAYEVLSDADKRQVYDEG 67
            ||::|||:.:|:|:::||||||.|||:||||||...|    |||.:::||||||||.||.:||:.
  Rat     4 YYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKY 68

  Fly    68 GEAAIKKGGADSGD-----------FRNPMDFFEKFFG--------------------------- 94
            |:..:..||...|.           ||||.|.|.:|||                           
  Rat    69 GKEGLNGGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFDDFFGNRRGPRGS 133

  Fly    95 ---------------------------------------------AGFGGSGGGRRRE------- 107
                                                         |.|||||.|..:.       
  Rat   134 RSRGAGSFFSAFSGFPSFGSGFPAFDTGFTPFGSLGHGGLTSFSSASFGGSGMGNFKSISTSTKI 198

  Fly   108 RRGKDVV-------HQMSVQLEELYNGATRKLQL----QKNVICDKCEGRG 147
            ..||.:.       .|..|::||  :|..:.|.:    .:|.:.::|..||
  Rat   199 VNGKKITTKRIVENGQERVEVEE--DGQLKSLTINGVADENALAEECRRRG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 70/246 (28%)
DnaJ 7..65 CDD:278647 36/61 (59%)
DnaJ_C 112..336 CDD:199909 10/47 (21%)
DnaJ_zf 140..206 CDD:199908 3/8 (38%)
Dnajb6XP_006235925.1 DnaJ 2..>107 CDD:223560 50/102 (49%)
DnaJ 3..66 CDD:278647 36/61 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.