powered by:
Protein Alignment Droj2 and Dnajc24
DIOPT Version :9
Sequence 1: | NP_650283.1 |
Gene: | Droj2 / 41646 |
FlyBaseID: | FBgn0038145 |
Length: | 403 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001178782.1 |
Gene: | Dnajc24 / 362184 |
RGDID: | 1564710 |
Length: | 148 |
Species: | Rattus norvegicus |
Alignment Length: | 68 |
Identity: | 25/68 - (36%) |
Similarity: | 39/68 - (57%) |
Gaps: | 9/68 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNE---------GEKFKAISQAYEVLSDADKRQ 62
:|.|||..|:|...:||:.|:||.|.|||||...: .:||..|.||:::|.:.:.::
Rat 11 WYSILGADPSADVSDLKQKYQKLILLYHPDKQSADVPAGTMEECVQKFIEIDQAWKILGNEETKK 75
Fly 63 VYD 65
.||
Rat 76 KYD 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.