DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnaja3

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001033684.2 Gene:Dnaja3 / 360481 RGDID:1306527 Length:480 Species:Rattus norvegicus


Alignment Length:397 Identity:103/397 - (25%)
Similarity:174/397 - (43%) Gaps:74/397 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN---PNEGEKFKAISQAYEVLSDADKRQVYDEGG 68
            ||.||||..||:..::||||.:||.|||||.|   |...|||..:::|||||||..||:.||..|
  Rat    94 YYQILGVPRNASQKDIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYG 158

  Fly    69 EAAIKKGGADSGD--FR-----NPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYN 126
            .|....|.:.||.  :|     :|.:.|.|.||. |..|..|..:....:...:.|.:...:...
  Rat   159 SAGFDPGASSSGQGYWRGGPSVDPEELFRKIFGE-FSSSPFGDFQNVFDQPQEYIMELTFNQAAK 222

  Fly   127 GATRKLQLQKNVICDKCEGRGGKKGS-IEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTG 190
            |..::..:.....|::|:|:|.:.|: ::.|..|.|:|:||  ....|.:|:   ..||:|.|.|
  Rat   223 GVNKEFTVNIMDTCERCDGKGNEPGTKVQHCHYCSGSGMET--INTGPFVMR---STCRRCGGRG 282

  Fly   191 ETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHS 255
            ..|  .:.|..|.|....:::|.:.|.:..|:.|||.:       ..|..: .:|.:....::..
  Rat   283 SII--TNPCVVCRGAGQAKQKKRVTVPVPAGVEDGQTV-------RMPVGK-REIFVTFRVQKSP 337

  Fly   256 TFAHAGQDLMMKMPLQLVEALCG----FQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPI 316
            .|...|.|:...:.:.:.:|:.|    .|.:.:|::     |:...|  |:.:....:..:|:|.
  Rat   338 VFRRDGADIHSDLFISIAQAILGGTAKAQGLYETIN-----VTIPAG--IQTDQKIRLTGKGIPR 395

  Fly   317 FKNPMEKGTLIIQFEVIFPEVINPSVVPTLKQCLPPAPEVDIPIDAEQTVLEDFDPKQRRQQHQR 381
            . |....|...|..::..|:.::                                   .|||:..
  Rat   396 I-NSYGYGDHYIHIKIRVPKRLS-----------------------------------SRQQNLI 424

  Fly   382 MAYDEDD 388
            ::|.||:
  Rat   425 LSYAEDE 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 103/397 (26%)
DnaJ 7..65 CDD:278647 33/60 (55%)
DnaJ_C 112..336 CDD:199909 47/228 (21%)
DnaJ_zf 140..206 CDD:199908 22/66 (33%)
Dnaja3NP_001033684.2 DnaJ 90..480 CDD:223560 103/397 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.