DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and l(3)80Fg

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster


Alignment Length:424 Identity:94/424 - (22%)
Similarity:167/424 - (39%) Gaps:88/424 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDILGVKPNATPDELKKAYRKLALKYHPDKNPNE--GEKFKAISQAYEVLSDADKRQVYDEGGEA 70
            |.|||:...||..|:::||::||.|:||||..|:  .|||..|..|||:|:|.|:|:::|..|.:
  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRYGVS 96

  Fly    71 AIKKGGADSGDFRNPMDFFE-KFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYNGATRKLQL 134
            .|     :|..|:...|:.| ..|.........|:|.:.: :|:.....:.:.|.|   ..|:.|
  Fly    97 DI-----NSQYFQKKHDYSEYNRFTLNQNDDDFGQRFDIK-QDIAFYQKLSITENY---FEKMIL 152

  Fly   135 QKNVICDKCEGRGGKKGSI-----EKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQ 194
            .||          .||..:     :.|.:|      ||:......|::.::.:....: |...:.
  Fly   153 SKN----------AKKVHVVMFYNDWCFKC------TRIVDAFKKILELLQPIGINFA-TVNAVH 200

  Fly   195 EKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEK------- 252
            |:...:.|..|:..:...:|         |.|..::.   ||  ...|..::..:.:|       
  Fly   201 EESVFRKCGAREVPQLVLIL---------DNQYFLYR---DH--SFTPQKVVEFIRKKIPFNVFK 251

  Fly   253 --EHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMP 315
              ||..|    .|.:.........||....|.:..|  |.|:.:.:..:.:.......|:::...
  Fly   252 RIEHDNF----NDFLGGWSDNRARALIFEPRSLTRL--RYLLTAFEFYDRVAFGFVNTISKDSSN 310

  Fly   316 I---FKNPMEKGTLIIQFEVIFPEVINPSVVPTLKQCLPPAPE------------VDIPIDAEQT 365
            |   ||......|||     :|.|   .:...|...|:...|.            :..|..:.|.
  Fly   311 IITRFKVNTSLDTLI-----LFNE---DTTTFTASVCMEEIPNHILVNMVSTNQFLAFPRISSQN 367

  Fly   366 VLEDFDPKQ--RRQQHQRMAYDEDDGGYQDGPRV 397
            ::|...|.:  |:::|..:....::...:|..||
  Fly   368 IMESVCPTEWNRQRKHLCVILITENNRKKDFERV 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 94/424 (22%)
DnaJ 7..65 CDD:278647 28/58 (48%)
DnaJ_C 112..336 CDD:199909 43/240 (18%)
DnaJ_zf 140..206 CDD:199908 10/70 (14%)
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 29/61 (48%)
DnaJ 30..91 CDD:278647 28/58 (48%)
TRX_DnaJ 134..244 CDD:239261 23/143 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.