DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and DNAJA1

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001530.1 Gene:DNAJA1 / 3301 HGNCID:5229 Length:397 Species:Homo sapiens


Alignment Length:400 Identity:246/400 - (61%)
Similarity:310/400 - (77%) Gaps:15/400 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYD 65
            |||||.|||:||||||||.:||||||||||||||||||||||||||.|||||||||||.||::||
Human     1 MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYD 65

  Fly    66 EGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGR-RRERRGKDVVHQMSVQLEELYNGAT 129
            :|||.|||:||| .|.|.:|||.|:.|||      |||| :||||||:||||:||.||:||||||
Human    66 KGGEQAIKEGGA-GGGFGSPMDIFDMFFG------GGGRMQRERRGKNVVHQLSVTLEDLYNGAT 123

  Fly   130 RKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQ 194
            |||.||||||||||||||||||::|.|..|||.|::.|:.||.||::|.|:.||.:|.|.||.|.
Human   124 RKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERIS 188

  Fly   195 EKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAH 259
            .|||||:|:|||.|||:|:|||||:|||:|||||.|.||||.||..:||||||:||:|:|:.|..
Human   189 PKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTR 253

  Fly   260 AGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKG 324
            .|:||.|.|.:||||||||||:.:.|||:|.:::::.||::::|...||:..|||||::.|.|||
Human   254 RGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKG 318

  Fly   325 TLIIQFEVIFPE--VINPSVVPTLKQCLPPAPEVDIPIDAEQTVLEDFDPKQRRQQHQR-MAYDE 386
            .|||:|:|.|||  .::|..:..|::.||...||:...:.:|..|.||||.|.|::|.. .||::
Human   319 RLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYED 383

  Fly   387 DD----GGYQ 392
            |:    ||.|
Human   384 DEHHPRGGVQ 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 244/398 (61%)
DnaJ 7..65 CDD:278647 50/57 (88%)
DnaJ_C 112..336 CDD:199909 138/223 (62%)
DnaJ_zf 140..206 CDD:199908 39/65 (60%)
DNAJA1NP_001530.1 PTZ00037 2..394 CDD:240236 244/398 (61%)
CXXCXGXG motif 134..141 6/6 (100%)
CXXCXGXG motif 150..157 4/6 (67%)
CXXCXGXG motif 177..184 3/6 (50%)
CXXCXGXG motif 193..200 4/6 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..397 15/41 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 312 1.000 Domainoid score I1310
eggNOG 1 0.900 - - E2759_KOG0712
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 505 1.000 Inparanoid score I1350
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1012379at2759
OrthoFinder 1 1.000 - - FOG0000718
OrthoInspector 1 1.000 - - otm41565
orthoMCL 1 0.900 - - OOG6_100614
Panther 1 1.100 - - O PTHR43888
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R684
SonicParanoid 1 1.000 - - X359
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.