DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Droj2 and CG32641

DIOPT Version :9

Sequence 1:	NP_650283.1	Gene:	Droj2 / 41646	FlyBaseID:	FBgn0038145	Length:	403	Species:	Drosophila melanogaster
Sequence 2:	NP_727675.1	Gene:	CG32641 / 318136	FlyBaseID:	FBgn0052641	Length:	132	Species:	Drosophila melanogaster

Alignment Length:	64	Identity:	33/64 - (51%)
Similarity:	46/64 - (71%)	Gaps:	2/64 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 ETGYYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYD 65
            |..||.||||..|||.:|:::||:::||.||||||  |....:|:.|::|:.|||||..|:.||
  Fly     2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYD 65

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Droj2	NP_650283.1	PTZ00037	2..398	CDD:240236	33/64 (52%)
		DnaJ	7..65	CDD:278647	30/59 (51%)
		DnaJ_C	112..336	CDD:199909
		DnaJ_zf	140..206	CDD:199908
CG32641	NP_727675.1	DnaJ	4..65	CDD:278647	30/60 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.910