DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajb5

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_038966057.1 Gene:Dnajb5 / 313811 RGDID:1307453 Length:420 Species:Rattus norvegicus


Alignment Length:405 Identity:128/405 - (31%)
Similarity:186/405 - (45%) Gaps:123/405 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||.|||:...|..||:||||||:|||||||||  ||..||||.|::||:||||..||.:||:.||
  Rat    77 YYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLYDQYGE 141

  Fly    70 AAIKKGGADS----GDFR------------------NPMDFF----------------------- 89
            ..:|.||..|    |.|.                  ||.|.|                       
  Rat   142 EGLKTGGGTSGGSGGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDED 206

  Fly    90 EKFFGA----GFGGSGGGRRR-------ERRGKD--VVHQMSVQLEELYNGATRKLQLQKNVICD 141
            |..|||    ||.|...|.||       .|:.:|  |||::.|.|||:|:|:|:::::.:     
  Rat   207 EDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITR----- 266

  Fly   142 KCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRK 206
                                                      |:.:..|.|::.:|         
  Rat   267 ------------------------------------------RRLNPDGRTVRTED--------- 280

  Fly   207 TVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQ 271
                 |:|.:.|::|.::|.||.|..|||..|::.|.||:.:|.:|.|:.|...|.:::....:.
  Rat   281 -----KILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALIS 340

  Fly   272 LVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPE 336
            |.|||||....:.|:|.|  ::.....:||:....|.:..||:|..|.|.::|.||::|:|.||:
  Rat   341 LKEALCGCTVNIPTIDGR--VIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPD 403

  Fly   337 VINPSVVPTLKQCLP 351
            .:.|.....|||.||
  Rat   404 RLTPQTRQILKQHLP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 128/405 (32%)
DnaJ 7..65 CDD:278647 38/59 (64%)
DnaJ_C 112..336 CDD:199909 58/225 (26%)
DnaJ_zf 140..206 CDD:199908 4/65 (6%)
Dnajb5XP_038966057.1 DnaJ 72..415 CDD:223560 124/400 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.