DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajb13

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001005885.1 Gene:Dnajb13 / 308857 RGDID:1359131 Length:316 Species:Rattus norvegicus


Alignment Length:377 Identity:107/377 - (28%)
Similarity:164/377 - (43%) Gaps:100/377 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||.:|.|..|:...::||||||||||.||.|:  |...|.|:.|::||:||||..||.:||:.||
  Rat     5 YYAVLQVNRNSEDAQIKKAYRKLALKNHPLKSNEPTAPEIFRQIAEAYDVLSDPVKRGIYDKFGE 69

  Fly    70 AAIKKG-----GADS---------GDFRNPMDFFEKFFGA-----------------GFGGSGGG 103
            ..:|.|     |:.:         |   ||...|.:|||.                 .|||. .|
  Rat    70 EGLKGGIPLEFGSQTPWTTGYVFHG---NPEKVFHEFFGGDNPFSEFFDAEGNDIDLNFGGL-RG 130

  Fly   104 RRRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRV 168
            |..:::...:...:.:.||:|:.|.|:|:::.:.|:.:                           
  Rat   131 RGVQKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNE--------------------------- 168

  Fly   169 QQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGE 233
                              .|...||::                |:|.:.:..|.|.|.:|.|..|
  Rat   169 ------------------DGYSSTIKD----------------KILTIDVRPGWRQGTRITFEKE 199

  Fly   234 GDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPG 298
            ||..|...|.|||.::.||.|..|.....:|....|:.|.:||......|||||||  :::....
  Rat   200 GDQGPNIIPADIIFIVKEKLHPRFRREQDNLFFVYPIPLGKALTCCTVEVKTLDDR--LLNIPIN 262

  Fly   299 EVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPEVINPSVVPTLKQCL 350
            :::..:..|.:..||||:.::|.:||.|.|.|::.||..:.|.....|:|.|
  Rat   263 DIVHPKYFKMVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 107/377 (28%)
DnaJ 7..65 CDD:278647 30/59 (51%)
DnaJ_C 112..336 CDD:199909 53/223 (24%)
DnaJ_zf 140..206 CDD:199908 3/65 (5%)
Dnajb13NP_001005885.1 DnaJ 1..312 CDD:223560 105/373 (28%)
DnaJ 4..65 CDD:278647 30/59 (51%)
DnaJ_C 138..302 CDD:199909 54/226 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.