DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajb4

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001013094.1 Gene:Dnajb4 / 295549 RGDID:1305826 Length:337 Species:Rattus norvegicus


Alignment Length:397 Identity:123/397 - (30%)
Similarity:185/397 - (46%) Gaps:118/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||.|||::..||.:::||||||.|||:|||||  |...||||.:::|||||||..||::||:.||
  Rat     5 YYHILGIEKGATDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQFGE 69

  Fly    70 AAIK--KGGAD--SGDFR------------------NPMDFFEKFFG------------------ 94
            ..:|  .||.|  .|.||                  ||   ||.|||                  
  Rat    70 EGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGANP---FEIFFGRRMGGGRDSEEMEIDGDP 131

  Fly    95 -AGFGGSGGGRRRER---------RGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGK 149
             :.||.|..|..|:|         :...::|::.|.|||:|:|.|:::::.:..:          
  Rat   132 FSAFGFSMNGYPRDRNSVGPSRLKQDPPIIHELKVSLEEIYSGCTKRMKISRKRL---------- 186

  Fly   150 KGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVL 214
                                                               |..||....|.|:|
  Rat   187 ---------------------------------------------------NPDGRSYRSEDKIL 200

  Fly   215 EVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGF 279
            .:.|:||.::|.||.|..|||..|.|.|.||:.::.:|||..|...|.:::....:.|.|||||.
  Rat   201 TIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKDKEHPKFKRDGSNIVYTAKISLREALCGC 265

  Fly   280 QRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPEVINPSVVP 344
            ...|.|:|.|::.:|..  ::::..|.:.|...|:|..|||.::|.|:|:|:|.||:||:.:...
  Rat   266 SINVPTMDGRNIPMSVT--DIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFDVSFPDVISAASKE 328

  Fly   345 TLKQCLP 351
            .|::.||
  Rat   329 ILRKHLP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 123/397 (31%)
DnaJ 7..65 CDD:278647 35/59 (59%)
DnaJ_C 112..336 CDD:199909 58/223 (26%)
DnaJ_zf 140..206 CDD:199908 2/65 (3%)
Dnajb4NP_001013094.1 DnaJ 1..332 CDD:223560 121/392 (31%)
DnaJ 4..65 CDD:278647 35/59 (59%)
DnaJ_C 158..320 CDD:199909 58/224 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.