DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajb12

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001013929.1 Gene:Dnajb12 / 294513 RGDID:1359677 Length:378 Species:Rattus norvegicus


Alignment Length:155 Identity:65/155 - (41%)
Similarity:80/155 - (51%) Gaps:35/155 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGG- 68
            ||:||||..:|:.::|||||||||||:|||||  |...|.||||..||.|||:.:||:.||:.| 
  Rat   112 YYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGD 176

  Fly    69 ---EAAIKKGGADSGDFR-------NPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEE 123
               :||  :.|...|||.       :|.|.|..|||.||..|.            ||..|     
  Rat   177 DKNQAA--RHGHSHGDFHRGFEADISPEDLFNMFFGGGFPSSN------------VHVYS----- 222

  Fly   124 LYNGATRKLQLQKNVICDKCEGRGG 148
              ||..|....|:....|. :|.||
  Rat   223 --NGRMRYTYQQRQDRRDN-QGDGG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 65/155 (42%)
DnaJ 7..65 CDD:278647 36/59 (61%)
DnaJ_C 112..336 CDD:199909 11/37 (30%)
DnaJ_zf 140..206 CDD:199908 4/9 (44%)
Dnajb12NP_001013929.1 DnaJ 111..172 CDD:278647 36/59 (61%)
DUF1977 269..369 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.