DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajc18

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006254608.1 Gene:Dnajc18 / 291677 RGDID:1310237 Length:357 Species:Rattus norvegicus


Alignment Length:134 Identity:54/134 - (40%)
Similarity:69/134 - (51%) Gaps:25/134 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            |||||||..||:.:||||||:|||||:|||||  |...:.||||..|:.|||:.|||..|||.|:
  Rat    83 YYDILGVSHNASDEELKKAYKKLALKFHPDKNCAPGATDAFKAIGNAFAVLSNPDKRLRYDEYGD 147

  Fly    70 AAIKKGGADSGDFR---------NPMDFFEKFFGAGFGGSGG-------------GRRRERRGKD 112
            ..:......:..:.         :|.:.|..|||..| .||.             .|||.|..:.
  Rat   148 EQVTLTAPRARPYHYYRDVEADISPEELFNVFFGGHF-PSGNIHMFSNVTDDSHYYRRRHRHERT 211

  Fly   113 VVHQ 116
            ..|:
  Rat   212 QAHK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 54/134 (40%)
DnaJ 7..65 CDD:278647 37/59 (63%)
DnaJ_C 112..336 CDD:199909 1/5 (20%)
DnaJ_zf 140..206 CDD:199908
Dnajc18XP_006254608.1 DnaJ 82..143 CDD:278647 37/59 (63%)
DUF1977 250..349 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.