DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajb9

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_038788.2 Gene:Dnajb9 / 27362 MGIID:1351618 Length:222 Species:Mus musculus


Alignment Length:196 Identity:58/196 - (29%)
Similarity:86/196 - (43%) Gaps:56/196 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            |||||||..:|:..::|||:.|||:|||||||  |:...||:.|::|||.||||:.|:.||..|.
Mouse    27 YYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANSRKEYDTIGH 91

  Fly    70 AAIKKGGADSG--------------DFRNPMDFF--------EKFFGAGFGGSGGGRRRERR--- 109
            :|...|....|              |.....:||        :|.|...|.....|..|:|.   
Mouse    92 SAFTNGKGQRGNGSPFEQSFNFNFDDLFKDFNFFGQNQNTRSKKHFENHFHTRQDGSSRQRHHFQ 156

  Fly   110 -----------------------GKDVVHQMSVQLEELYNGATRK----LQLQKNVIC--DKCEG 145
                                   |.|..::.:||.|..::|:::.    .|.:.|::.  ..|.|
Mouse   157 EFSFGGGLFDDMFEDMEKMFSFSGFDTTNRHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSG 221

  Fly   146 R 146
            :
Mouse   222 Q 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 58/196 (30%)
DnaJ 7..65 CDD:278647 33/59 (56%)
DnaJ_C 112..336 CDD:199909 9/41 (22%)
DnaJ_zf 140..206 CDD:199908 2/9 (22%)
Dnajb9NP_038788.2 DnaJ 26..87 CDD:278647 33/59 (56%)
Divergent targeting domain. /evidence=ECO:0000305 91..222 21/130 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.