DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and DNAJB5

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens


Alignment Length:419 Identity:131/419 - (31%)
Similarity:189/419 - (45%) Gaps:133/419 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KETG----------YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVL 55
            |||.          ||.|||:...|..||:||||||:|||||||||  ||..||||.|::||:||
Human    63 KETSAGPVAVMGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVL 127

  Fly    56 SDADKRQVYDEGGEAAIKKG----GADSGDFR------------------NPMDFF--------- 89
            ||..||.:||:.||..:|.|    |..||.|.                  ||.|.|         
Human   128 SDPKKRGLYDQYGEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRP 192

  Fly    90 --------------EKFFGA----GFGGSGGGRRR-------ERRGKD--VVHQMSVQLEELYNG 127
                          |..|||    ||.|...|.||       .|:.:|  |||::.|.|||:|:|
Human   193 FSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHG 257

  Fly   128 ATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGET 192
            :|:::::.:                                               |:.:..|.|
Human   258 STKRMKITR-----------------------------------------------RRLNPDGRT 275

  Fly   193 IQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTF 257
            ::.:|              |:|.:.|::|.::|.||.|..|||..|::.|.||:.:|.:|.|:.|
Human   276 VRTED--------------KILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHF 326

  Fly   258 AHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPME 322
            ...|.:::....:.|.|||||....:.|:|.|  ::.....:||:....|.:..||:|..|.|.:
Human   327 RRDGTNVLYSALISLKEALCGCTVNIPTIDGR--VIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQ 389

  Fly   323 KGTLIIQFEVIFPEVINPSVVPTLKQCLP 351
            :|.||::|:|.||:.:.|.....|||.||
Human   390 RGDLIVEFKVRFPDRLTPQTRQILKQHLP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 131/419 (31%)
DnaJ 7..65 CDD:278647 38/59 (64%)
DnaJ_C 112..336 CDD:199909 58/225 (26%)
DnaJ_zf 140..206 CDD:199908 4/65 (6%)
DNAJB5NP_001128477.1 DnaJ 72..415 CDD:223560 124/405 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.