DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajb9

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_038967719.1 Gene:Dnajb9 / 24908 RGDID:3070 Length:234 Species:Rattus norvegicus


Alignment Length:196 Identity:60/196 - (30%)
Similarity:89/196 - (45%) Gaps:56/196 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            |||||||..:|:..::|||:.|||:|||||||  |:...||:.|::|||.||||::|:.||..|.
  Rat    39 YYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDIIGH 103

  Fly    70 AAIK--KGGADSGD-FRNPMDF-----------------------FEKFFGAGFGGS-------- 100
            :|..  ||...:|. |....:|                       ||..|.....||        
  Rat   104 SAFTNGKGQRSNGSPFEQSFNFNFDDLFKDFNLFGQNQNTRSKKHFENHFQTRQDGSSRQRHHFQ 168

  Fly   101 ----GGG----------RRRERRGKDVVHQMSVQLEELYNGATRK----LQLQKNVIC--DKCEG 145
                |||          :.....|.|..::.:||.|..::|:::.    .|.:.|::.  ..|.|
  Rat   169 EFSFGGGLFDDMFEDMEKMFSFSGFDSTNRRTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSG 233

  Fly   146 R 146
            :
  Rat   234 Q 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 60/196 (31%)
DnaJ 7..65 CDD:278647 33/59 (56%)
DnaJ_C 112..336 CDD:199909 9/41 (22%)
DnaJ_zf 140..206 CDD:199908 2/9 (22%)
Dnajb9XP_038967719.1 DnaJ 35..>147 CDD:223560 42/107 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.