Sequence 1: | NP_650283.1 | Gene: | Droj2 / 41646 | FlyBaseID: | FBgn0038145 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038967719.1 | Gene: | Dnajb9 / 24908 | RGDID: | 3070 | Length: | 234 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 60/196 - (30%) |
---|---|---|---|
Similarity: | 89/196 - (45%) | Gaps: | 56/196 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
Fly 70 AAIK--KGGADSGD-FRNPMDF-----------------------FEKFFGAGFGGS-------- 100
Fly 101 ----GGG----------RRRERRGKDVVHQMSVQLEELYNGATRK----LQLQKNVIC--DKCEG 145
Fly 146 R 146 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Droj2 | NP_650283.1 | PTZ00037 | 2..398 | CDD:240236 | 60/196 (31%) |
DnaJ | 7..65 | CDD:278647 | 33/59 (56%) | ||
DnaJ_C | 112..336 | CDD:199909 | 9/41 (22%) | ||
DnaJ_zf | 140..206 | CDD:199908 | 2/9 (22%) | ||
Dnajb9 | XP_038967719.1 | DnaJ | 35..>147 | CDD:223560 | 42/107 (39%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |